CacheBy
Atlas Antibodies Anti-NAA35 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NAA35 Antibody

상품 한눈에 보기

Human NAA35 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, 높은 종간 보존성을 보입니다. PBS와 글리세롤 버퍼에 보존제로 sodium azide가 포함되어 있습니다.

카탈로그번호
HPA051586-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051586-100 Anti-NAA35 Antibody, N(alpha)-acetyltransferase 35, NatC auxiliary subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051586-25 Anti-NAA35 Antibody, N(alpha)-acetyltransferase 35, NatC auxiliary subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NAA35 Antibody

Anti-NAA35 Antibody

N(alpha)-acetyltransferase 35, NatC auxiliary subunit

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human NAA35.

Alternative Gene Names

bA379P1.1, FLJ21613, FLJ22643, MAK10

Open Datasheet (PDF)

Target Information

  • Target Protein: N(alpha)-acetyltransferase 35, NatC auxiliary subunit
  • Target Gene: NAA35
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKPKFELDSEQVRYEHRFAPFNSVMTPPPVHYLQFKEMSDLNKYSPPPQSPELYVAASKHFQQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000021555 (100%)
  • Rat ENSRNOG00000018417 (98%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.