Atlas Antibodies Anti-MUC21 Antibody

상품 한눈에 보기

인간 MUC21 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 오소고날 검증에 적합. PrEST 항원을 이용해 친화 정제됨. RNA-seq 데이터와 비교한 단백질 발현 검증 지원. 고품질 글리세롤 기반 완충액 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA052028-100 Anti-MUC21 Antibody, mucin 21, cell surface associated 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA052028-25 Anti-MUC21 Antibody, mucin 21, cell surface associated 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: mucin 21, cell surface associated
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human MUC21.

bCX31G15.2, C6orf205

항목	내용
Target Protein	mucin 21, cell surface associated
Target Gene	MUC21
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	CVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNS
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000090588 (34%), Rat ENSRNOG00000019423 (27%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet