CacheBy
Atlas Antibodies Anti-MUC12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MUC12 Antibody

상품 한눈에 보기

Human MUC12 단백질을 인식하는 폴리클로날 항체로, IHC 기반 정성 분석에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 특이적으로 반응하며, RNA-seq 데이터 기반 정교한 Orthogonal 검증이 완료되었습니다.

카탈로그번호
HPA023835-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023835-100 Anti-MUC12 Antibody, mucin 12, cell surface associated 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023835-25 Anti-MUC12 Antibody, mucin 12, cell surface associated 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MUC12 Antibody

Anti-MUC12 Antibody

mucin 12, cell surface associated


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human MUC12


Alternative Gene Names

MUC11

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein mucin 12, cell surface associated
Target Gene MUC12
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EELFENLAEIVKAKIMNETRTTLLDPDSCRKAILCYSEEDTFVDSSVTPGFDFQEQCTQKAAEGYTQFYYVDVLDGKLACVNKCTKGTKSQMNCNLGTCQLQRSGPRCLCPNTNTHWYWG

Verified Species Reactivity

Human


Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000049592 52%
Mouse ENSMUSG00000037390 35%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.