CacheBy
Atlas Antibodies Anti-MTMR11 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MTMR11 Antibody

상품 한눈에 보기

인간 MTMR11 단백질을 타깃으로 하는 토끼 폴리클로날 항체. IHC 및 ICC 실험에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 반응하고 쥐·랫드와 높은 서열 유사성을 가짐. 안정한 PBS/glycerol 완충액에 보존됨.

카탈로그번호
HPA030351-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030351-100 Anti-MTMR11 Antibody, myotubularin related protein 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030351-25 Anti-MTMR11 Antibody, myotubularin related protein 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MTMR11 Antibody

Anti-MTMR11 Antibody

Target: Myotubularin related protein 11 (MTMR11)
Type: Polyclonal antibody against human MTMR11
Host: Rabbit
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human myotubularin related protein 11 (MTMR11), generated using a recombinant PrEST antigen.


Alternative Gene Names

  • CRA

Target Information

항목 내용
Target Protein Myotubularin related protein 11
Target Gene MTMR11
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FLLALHDSVRVPDTLTFLRNTPWERGKQSGQLNSYTQVYTPGYSQPPAGNSFNLQLSVWDWDLRYSNAQILQFQNPGYDPEHCPDSWLPRPQPSFMVPG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000021176 (84%)
  • Mouse ENSMUSG00000045934 (82%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.