CacheBy
Atlas Antibodies Anti-MTIF3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MTIF3 Antibody

상품 한눈에 보기

Human MTIF3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 고순도 IgG 형태로 제공됩니다. 인간에 대한 반응성이 검증된 고품질 연구용 항체입니다.

카탈로그번호
HPA039791-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039791-100 Anti-MTIF3 Antibody, mitochondrial translational initiation factor 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039791-25 Anti-MTIF3 Antibody, mitochondrial translational initiation factor 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MTIF3 Antibody

Anti-MTIF3 Antibody

Target Information

  • Target Protein: Mitochondrial translational initiation factor 3
  • Target Gene: MTIF3
  • Alternative Gene Names: IF-3mt, IF3(mt)

Product Description

Polyclonal Antibody against Human MTIF3

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000016510 66%
Rat ENSRNOG00000047329 61%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.