CacheBy
Atlas Antibodies Anti-MTM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MTM1 Antibody

상품 한눈에 보기

Human MTM1 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원으로 affinity purification 수행. 높은 종간 서열 유사성(인간-마우스 93%, 인간-랫 84%). PBS/glycerol buffer에 sodium azide 보존제 포함.

카탈로그번호
HPA010008-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010008-100 Anti-MTM1 Antibody, myotubularin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010008-25 Anti-MTM1 Antibody, myotubularin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MTM1 Antibody

Anti-MTM1 Antibody

Target Information

  • Target Protein: Myotubularin 1
  • Target Gene: MTM1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KFNVDGWTVYNPVEEYRRQGLPNHHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIVRCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNAVANK

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000031337 93%
Rat ENSRNOG00000002516 84%

Product Description

Polyclonal antibody against human MTM1.
Affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Technical Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen
Safety Information Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.