CacheBy
Atlas Antibodies Anti-MTM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MTM1 Antibody

상품 한눈에 보기

Human MTM1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. PBS/glycerol buffer에 보존제로 sodium azide가 포함되어 있습니다.

카탈로그번호
HPA010665-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010665-100 Anti-MTM1 Antibody, myotubularin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010665-25 Anti-MTM1 Antibody, myotubularin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MTM1 Antibody

Anti-MTM1 Antibody

Target Information

  • Target Protein: Myotubularin 1
  • Target Gene: MTM1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KFNVDGWTVYNPVEEYRRQGLPNHHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIVRCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNAVANK

Product Description

Polyclonal antibody against human MTM1.

Open Datasheet

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000031337 (93%)
  • Rat ENSRNOG00000002516 (84%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.