CacheBy
Atlas Antibodies Anti-MTFR2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MTFR2 Antibody

상품 한눈에 보기

Human MTFR2 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC 및 WB 실험에 적합하며, PrEST 항원으로 정제되었습니다. Human에 특이적으로 반응하며 DUFD1, FAM54A 등 대체 유전자명으로도 알려져 있습니다.

카탈로그번호
HPA029794-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029794-100 Anti-MTFR2 Antibody, mitochondrial fission regulator 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029794-25 Anti-MTFR2 Antibody, mitochondrial fission regulator 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MTFR2 Antibody

Anti-MTFR2 Antibody

Target Information

  • Protein: Mitochondrial Fission Regulator 2
  • Gene: MTFR2
  • Alternative Gene Names: DUFD1, FAM54A
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human MTFR2.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PLSPAVRQKETVKNDLPVNEAAIRKIAALENELTFLRSQIAAIVEMQELKNSTNSSSFGLSDE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000019992 67%
Rat ENSRNOG00000058050 59%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.