CacheBy
Atlas Antibodies Anti-MTG2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MTG2 Antibody

상품 한눈에 보기

Human MTG2 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산된 IgG 형태이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 반응성이 검증되었으며, 높은 종간 서열 유사도를 보입니다.

카탈로그번호
HPA047379-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047379-100 Anti-MTG2 Antibody, mitochondrial ribosome-associated GTPase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047379-25 Anti-MTG2 Antibody, mitochondrial ribosome-associated GTPase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MTG2 Antibody

Anti-MTG2 Antibody

Target: mitochondrial ribosome-associated GTPase 2 (MTG2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human MTG2.


Alternative Gene Names

dJ1005F21.2, FLJ10741, GTPBP5, ObgH1

Open Datasheet


Target Information

  • Target Protein: mitochondrial ribosome-associated GTPase 2
  • Target Gene: MTG2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPV

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000059919 87%
Mouse ENSMUSG00000039069 86%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.