Atlas Antibodies Anti-MRPS15 Antibody

상품 한눈에 보기

인체 MRPS15 단백질을 표적으로 하는 토끼 다클론 항체로, IHC 및 WB 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었으며, 고순도의 Affinity purification 방식으로 제조되었습니다. PBS 기반 buffer와 sodium azide 보존제가 포함되어 있습니다.

카탈로그번호: HPA028100-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028100-100 Anti-MRPS15 Antibody, mitochondrial ribosomal protein S15 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028100-25 Anti-MRPS15 Antibody, mitochondrial ribosomal protein S15 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MRPS15 Antibody

Anti-MRPS15 Antibody

Target: Mitochondrial ribosomal protein S15
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
WB (Western Blot)

Product Description

Polyclonal antibody against human MRPS15.

Alternative Gene Names

FLJ11564

Target Information

항목	내용
Target Protein	Mitochondrial ribosomal protein S15
Target Gene	MRPS15
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000008279 (61%), Mouse ENSMUSG00000028861 (57%)

Antigen Sequence:

GLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDS

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand