CacheBy
Atlas Antibodies Anti-MRPS18A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPS18A Antibody

상품 한눈에 보기

Human MRPS18A 단백질을 인식하는 Rabbit Polyclonal 항체로, 미토콘드리아 리보솜 단백질 연구에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 사용 가능. Human에 대해 검증됨.

카탈로그번호
HPA035451-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035451-100 Anti-MRPS18A Antibody, mitochondrial ribosomal protein S18A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035451-25 Anti-MRPS18A Antibody, mitochondrial ribosomal protein S18A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPS18A Antibody

Anti-MRPS18A Antibody

Target: mitochondrial ribosomal protein S18A (MRPS18A)
Type: Polyclonal Antibody against Human MRPS18A


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against Human MRPS18A.
Validated for use in human samples.


Alternative Gene Names

  • FLJ10548
  • MRPS18-3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein mitochondrial ribosomal protein S18A
Target Gene MRPS18A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000023967 (47%), Rat ENSRNOG00000019511 (46%)

Antigen Sequence:
DVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGRRPWGPRGAEGCRHSLPTQLPHVSAPPGRKVDIRSVNYTHHPMPTFPLPWAFPL


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.