
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPL53 Antibody
상품 한눈에 보기
인간 MRPL53 단백질을 인식하는 폴리클로날 항체. 면역세포화학(ICC) 등 다양한 응용에 적합. 토끼에서 생성된 IgG 항체로, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증됨. 글리세롤/PBS 완충액에 보존제 포함.
- 카탈로그번호
- HPA034612-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034612-100 Anti-MRPL53 Antibody, mitochondrial ribosomal protein L53 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034612-25 Anti-MRPL53 Antibody, mitochondrial ribosomal protein L53 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPL53 Antibody
Anti-MRPL53 Antibody
Target: mitochondrial ribosomal protein L53 (MRPL53)
Type: Polyclonal Antibody against Human MRPL53
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human mitochondrial ribosomal protein L53 (MRPL53).
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence used for immunization.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein L53 |
| Target Gene | MRPL53 |
| Antigen Sequence | KQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (93%), Rat (92%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



