CacheBy
Atlas Antibodies Anti-MRPL53 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPL53 Antibody

상품 한눈에 보기

인간 MRPL53 단백질을 인식하는 폴리클로날 항체. 면역세포화학(ICC) 등 다양한 응용에 적합. 토끼에서 생성된 IgG 항체로, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증됨. 글리세롤/PBS 완충액에 보존제 포함.

카탈로그번호
HPA034612-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034612-100 Anti-MRPL53 Antibody, mitochondrial ribosomal protein L53 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034612-25 Anti-MRPL53 Antibody, mitochondrial ribosomal protein L53 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPL53 Antibody

Anti-MRPL53 Antibody

Target: mitochondrial ribosomal protein L53 (MRPL53)
Type: Polyclonal Antibody against Human MRPL53


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human mitochondrial ribosomal protein L53 (MRPL53).
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence used for immunization.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein mitochondrial ribosomal protein L53
Target Gene MRPL53
Antigen Sequence KQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALE
Verified Species Reactivity Human
Interspecies Identity Mouse (93%), Rat (92%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications: ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.