CacheBy
Atlas Antibodies Anti-MRPL53 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPL53 Antibody

상품 한눈에 보기

Human MRPL53 단백질을 인식하는 토끼 폴리클로날 항체로, 미토콘드리아 리보솜 단백질 L53 검출에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 활용 가능.

카탈로그번호
HPA056185-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056185-100 Anti-MRPL53 Antibody, mitochondrial ribosomal protein L53 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056185-25 Anti-MRPL53 Antibody, mitochondrial ribosomal protein L53 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPL53 Antibody

Anti-MRPL53 Antibody

Target: mitochondrial ribosomal protein L53 (MRPL53)

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human MRPL53.

Open Datasheet (PDF)

Target Information

  • Target Protein: mitochondrial ribosomal protein L53
  • Target Gene: MRPL53
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000030037): 93%
  • Rat (ENSRNOG00000053109): 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.