CacheBy
Atlas Antibodies Anti-ASB18 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ASB18 Antibody

상품 한눈에 보기

인간 ASB18 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 등 다양한 응용에 적합. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human에 대한 반응성이 검증되어 정확한 단백질 분석에 유용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068447-100 Anti-ASB18 Antibody, ankyrin repeat and SOCS box containing 18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068447-25 Anti-ASB18 Antibody, ankyrin repeat and SOCS box containing 18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ASB18 Antibody

Anti-ASB18 Antibody

Target Protein: ankyrin repeat and SOCS box containing 18
Target Gene: ASB18

면역조직화학 (IHC)

Product Description

Polyclonal Antibody against Human ASB18
Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DYLHDYPLNSDLVKRLKSALDAKDEERVRDLICTEITPVDAVIELANDDWMKDPSAQLPTGMLLGDLD

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000067081 72%
Rat ENSRNOG00000019557 71%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 농도 및 조건은 사용자가 결정해야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.