Atlas Antibodies Anti-ASB7 Antibody

상품 한눈에 보기

Human ASB7 단백질을 타겟으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용 가능. Orthogonal 및 recombinant expression 검증 완료. Rabbit 유래 IgG 항체로 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA003300-100 Anti-ASB7 Antibody, ankyrin repeat and SOCS box containing 7 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA003300-25 Anti-ASB7 Antibody, ankyrin repeat and SOCS box containing 7 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: ankyrin repeat and SOCS box containing 7 (ASB7)
Supplier: Atlas Antibodies

IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant Expression Validation): Recombinant expression validation in Western blot using target protein overexpression.
ICC: Suitable for immunocytochemistry applications.

Polyclonal Antibody against Human ASB7
Open Datasheet (PDF)

항목	내용
Target Protein	ankyrin repeat and SOCS box containing 7
Target Gene	ASB7
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000030509 (100%), Rat ENSRNOG00000013795 (100%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

HHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDK

Enhanced Validation
IHC Orthogonal
WB Recombinant Expression
ICC

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.