CacheBy
Atlas Antibodies Anti-ASB3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ASB3 Antibody

상품 한눈에 보기

휴먼 ASB3 단백질을 인식하는 폴리클로날 항체로, 래빗에서 생산됨. IHC 등 다양한 응용에 적합하며, 프레스티지 항원으로 친화 정제됨. 휴먼에 특이적으로 반응하며, 높은 종간 서열 유사성을 보임. 안정한 PBS/glycerol 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003940-100 Anti-ASB3 Antibody, ankyrin repeat and SOCS box containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003940-25 Anti-ASB3 Antibody, ankyrin repeat and SOCS box containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ASB3 Antibody

Anti-ASB3 Antibody

Target: ankyrin repeat and SOCS box containing 3 (ASB3)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human ASB3 protein.


Alternative Gene Names

  • ASB-3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ankyrin repeat and SOCS box containing 3
Target Gene ASB3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000032471 (90%), Mouse ENSMUSG00000020305 (89%)

Antigen Sequence

LHQASFQENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSGANVNCQALDKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRACDTGLNKV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.