CacheBy
Atlas Antibodies Anti-ASB9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ASB9 Antibody

상품 한눈에 보기

Human ASB9 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 호스트에서 생성되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다.

카탈로그번호
HPA003060-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003060-100 Anti-ASB9 Antibody, ankyrin repeat and SOCS box containing 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003060-25 Anti-ASB9 Antibody, ankyrin repeat and SOCS box containing 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ASB9 Antibody

Anti-ASB9 Antibody

Target: ankyrin repeat and SOCS box containing 9 (ASB9)
Type: Polyclonal Antibody against Human ASB9


  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody targeting human ASB9 protein.


Alternative Gene Names

  • DKFZP564L0862
  • FLJ20636
  • MGC4954

Open Datasheet


Target Information

항목 내용
Target Protein ankyrin repeat and SOCS box containing 9
Target Gene ASB9
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000003452 (72%), Mouse ENSMUSG00000031384 (72%)

Antigen Sequence:
GMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACV


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.