CacheBy
Atlas Antibodies Anti-ARHGEF40 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ARHGEF40 Antibody

상품 한눈에 보기

인간 ARHGEF40 단백질을 인식하는 폴리클로날 항체. 면역세포화학(ICC) 등 다양한 응용에 적합. 토끼에서 생산된 IgG 항체로, PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며, 생물학적 연구에 유용.

카탈로그번호
HPA030757-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030757-100 Anti-ARHGEF40 Antibody, Rho guanine nucleotide exchange factor (GEF) 40 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030757-25 Anti-ARHGEF40 Antibody, Rho guanine nucleotide exchange factor (GEF) 40 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ARHGEF40 Antibody

Anti-ARHGEF40 Antibody

Target: Rho guanine nucleotide exchange factor 40 (ARHGEF40)
Type: Polyclonal Antibody against Human ARHGEF40


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human ARHGEF40 protein.


Alternative Gene Names

  • FLJ10357
  • Solo

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Rho guanine nucleotide exchange factor 40
Target Gene ARHGEF40
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SQLQDSGDPPLVQRLLILIHDDLPTELCGFQGAEVLSENDLKRVAKPEELQWELGGHRDPSPSHWVEIHQEVVRLCRLCQGVLGS
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000052354 (82%), Mouse ENSMUSG00000004562 (82%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.