Atlas Antibodies Anti-ARHGEF40 Antibody

상품 한눈에 보기

Human ARHGEF40 단백질을 인식하는 Rabbit Polyclonal 항체로, Rho guanine nucleotide exchange factor 40 연구용에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, 다양한 응용에 활용 가능. Human 반응성 검증 완료.

카탈로그번호: HPA030746-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Primary Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030746-100 Anti-ARHGEF40 Antibody, Rho guanine nucleotide exchange factor (GEF) 40 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030746-25 Anti-ARHGEF40 Antibody, Rho guanine nucleotide exchange factor (GEF) 40 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ARHGEF40 Antibody

Anti-ARHGEF40 Antibody

Target: Rho guanine nucleotide exchange factor 40
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against Human ARHGEF40.

Alternative Gene Names

FLJ10357
solo

Open Datasheet

Target Information

항목	내용
Target Protein	Rho guanine nucleotide exchange factor 40
Target Gene	ARHGEF40
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000004562 (82%), Rat ENSRNOG00000052354 (82%)

Antigen Sequence:

SQLQDSGDPPLVQRLLILIHDDLPTELCGFQGAEVLSENDLKRVAKPEELQWELGGHRDPSPSHWVEIHQEVVRLCRLCQGVLGS

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS	Material Safety Data Sheet