
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-APOC2 Antibody
상품 한눈에 보기
Human APOC2 단백질을 인식하는 토끼 폴리클로날 항체로, apolipoprotein C-II 연구용으로 적합합니다. PrEST 항원으로 정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. Human 반응성이 검증되었습니다.
- 카탈로그번호
- HPA055877-xxx (2개 옵션)
- 카테고리
- Antibodies
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055877-100 Anti-APOC2 Antibody, apolipoprotein C-II 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055877-25 Anti-APOC2 Antibody, apolipoprotein C-II 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-APOC2 Antibody
Anti-APOC2 Antibody
Target Information
- Target Protein: apolipoprotein C-II
- Target Gene: APOC2
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
Product Description
Polyclonal antibody against human APOC2.
Recommended Applications
- Immunohistochemistry (IHC)
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000018402): 75%
- Mouse (ENSMUSG00000109350): 70%
Product Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



