CacheBy
Atlas Antibodies Anti-APOBR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-APOBR Antibody

상품 한눈에 보기

Human APOBR 단백질을 인식하는 폴리클로날 항체로, IHC Orthogonal 검증을 통해 단백질 발현을 RNA-seq 데이터와 비교 확인. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. Human에 특이적으로 반응하며, 다양한 연구용으로 적합.

카탈로그번호
HPA041667-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041667-100 Anti-APOBR Antibody, apolipoprotein B receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041667-25 Anti-APOBR Antibody, apolipoprotein B receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-APOBR Antibody

Anti-APOBR Antibody

Target: apolipoprotein B receptor (APOBR)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human APOBR (apolipoprotein B receptor).


Alternative Gene Names

  • APOB100R
  • APOB48R

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein apolipoprotein B receptor
Target Gene APOBR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EKWTLLEEEAVGWQEREQREDSEGRCGDYHPEGEAPRLLDAEGLMVTGGRRAEAKETEPESLEHVRGQEEQPTHQAPAEAAPESVGEA

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Information Highest antigen sequence identity to orthologs:
• Rat ENSRNOG00000017403 (34%)
• Mouse ENSMUSG00000037664 (30%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative.
Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.