Atlas Antibodies Anti-APOBR Antibody

상품 한눈에 보기

Human APOBR 단백질을 인식하는 폴리클로날 항체로, IHC Orthogonal 검증을 통해 단백질 발현을 RNA-seq 데이터와 비교 확인. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. Human에 특이적으로 반응하며, 다양한 연구용으로 적합.

카탈로그번호: HPA041667-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Primary Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041667-100 Anti-APOBR Antibody, apolipoprotein B receptor 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041667-25 Anti-APOBR Antibody, apolipoprotein B receptor 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-APOBR Antibody

Anti-APOBR Antibody

Target: apolipoprotein B receptor (APOBR)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human APOBR (apolipoprotein B receptor).

Alternative Gene Names

APOB100R
APOB48R

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	apolipoprotein B receptor
Target Gene	APOBR
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	EKWTLLEEEAVGWQEREQREDSEGRCGDYHPEGEAPRLLDAEGLMVTGGRRAEAKETEPESLEHVRGQEEQPTHQAPAEAAPESVGEA

Species Reactivity

항목	내용
Verified Species Reactivity	Human
Interspecies Information	Highest antigen sequence identity to orthologs: • Rat ENSRNOG00000017403 (34%) • Mouse ENSMUSG00000037664 (30%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand