AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-APCS Antibody
상품 한눈에 보기
Human APCS 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. Human에 반응하며, 안정적 PBS/glycerol buffer로 보존됩니다.
- 카탈로그번호
- HPA053294-xxx (2개 옵션)
- 카테고리
- Antibodies
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053294-100 Anti-APCS Antibody, amyloid P component, serum 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053294-25 Anti-APCS Antibody, amyloid P component, serum 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-APCS Antibody
Anti-APCS Antibody
Target Information
- Target Protein: amyloid P component, serum
- Target Gene: APCS
- Alternative Gene Names: MGC88159, PTX2, SAP
Product Description
Polyclonal Antibody against Human APCS.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
QEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000009086 | 71% |
| Mouse | ENSMUSG00000026542 | 67% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.