CacheBy
Atlas Antibodies Anti-APEH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-APEH Antibody

상품 한눈에 보기

Human APEH 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 독립적·직교적 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간 반응성 확인, 높은 종 간 항원 서열 동일성 보유.

카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029700-100 Anti-APEH Antibody, acylaminoacyl-peptide hydrolase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029700-25 Anti-APEH Antibody, acylaminoacyl-peptide hydrolase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-APEH Antibody

Anti-APEH Antibody

acylaminoacyl-peptide hydrolase

  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB Independent Validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal Antibody against Human APEH

Alternative Gene Names

D3F15S2, D3S48E, DNF15S2

Open Datasheet

Target Information

항목 내용
Target Protein acylaminoacyl-peptide hydrolase
Target Gene APEH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000032590 (86%)
  • Rat ENSRNOG00000029572 (86%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Independent
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.