
Atlas Antibodies Anti-APEH Antibody
상품 한눈에 보기
Human APEH 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 독립적·직교적 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간 반응성 확인, 높은 종 간 항원 서열 동일성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-APEH Antibody
acylaminoacyl-peptide hydrolase
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB Independent Validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal Antibody against Human APEH
Alternative Gene Names
D3F15S2, D3S48E, DNF15S2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | acylaminoacyl-peptide hydrolase |
| Target Gene | APEH |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000032590 (86%)
- Rat ENSRNOG00000029572 (86%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.




