Atlas Antibodies Anti-APEH Antibody

상품 한눈에 보기

Human APEH 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 독립적·직교적 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간 반응성 확인, 높은 종 간 항원 서열 동일성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029700-100 Anti-APEH Antibody, acylaminoacyl-peptide hydrolase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029700-25 Anti-APEH Antibody, acylaminoacyl-peptide hydrolase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

acylaminoacyl-peptide hydrolase

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Independent Validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC: Suitable for immunocytochemistry applications.

Polyclonal Antibody against Human APEH

D3F15S2, D3S48E, DNF15S2

항목	내용
Target Protein	acylaminoacyl-peptide hydrolase
Target Gene	APEH
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand