Atlas Antibodies Anti-ANXA7 Antibody

상품 한눈에 보기

Human ANXA7 단백질을 타깃으로 하는 rabbit polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 반응하며, Mouse 및 Rat과 91% 서열 유사성을 가집니다.

카탈로그번호: HPA064290-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA064290-100 Anti-ANXA7 Antibody, annexin A7 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA064290-25 Anti-ANXA7 Antibody, annexin A7 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ANXA7 Antibody

Anti-ANXA7 Antibody

Target Information

Target Protein: annexin A7
Target Gene: ANXA7
Alternative Gene Names: ANX7

Product Description

Polyclonal antibody against human ANXA7 (annexin A7).

Recommended Applications

Western Blot (WB)
Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000021814	91%
Rat	ENSRNOG00000007136	91%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)