Atlas Antibodies Anti-ANXA5 Antibody

상품 한눈에 보기

Human ANXA5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반 정합 검증(Orthogonal validation) 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공.

카탈로그번호: HPA035330-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035330-100 Anti-ANXA5 Antibody, annexin A5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035330-25 Anti-ANXA5 Antibody, annexin A5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ANXA5 Antibody

Anti-ANXA5 Antibody

Target Protein: annexin A5
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation)
WB (Western Blot)
ICC (Immunocytochemistry)

Orthogonal validation:
Protein expression validated using IHC by comparison to RNA-seq data of corresponding targets in high and low expression tissues.

Product Description

Polyclonal antibody against human ANXA5.

Alternative Gene Names

ANX5, ENX2

Open Datasheet (PDF)

Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAG

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000027712	95%
Rat	ENSRNOG00000014453	94%

Antibody Properties

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand