CacheBy
Atlas Antibodies Anti-ANKS4B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANKS4B Antibody

상품 한눈에 보기

Human ANKS4B 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human 반응성이 검증되었으며, 40% glycerol/PBS buffer에 보존됩니다.

카탈로그번호
HPA043523-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043523-100 Anti-ANKS4B Antibody, ankyrin repeat and sterile alpha motif domain containing 4B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043523-25 Anti-ANKS4B Antibody, ankyrin repeat and sterile alpha motif domain containing 4B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANKS4B Antibody

Anti-ANKS4B Antibody

Target: ankyrin repeat and sterile alpha motif domain containing 4B
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ANKS4B.

Alternative Gene Names

FLJ38819, HARP

Open Datasheet

Target Information

  • Target Protein: ankyrin repeat and sterile alpha motif domain containing 4B
  • Target Gene: ANKS4B
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VALLDKAATAQNIMNPKKVTRLKEQAQKNARRQIKECERLQEKHQNKMAHTYSKEESGTLSSSKGTFSRSSPSNASAP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000046181 82%
Mouse ENSMUSG00000030909 77%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.