CacheBy
Atlas Antibodies Anti-ANKS3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANKS3 Antibody

상품 한눈에 보기

인간 ANKS3 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합. Affinity purification 방식으로 높은 특이성과 순도를 제공. PBS/glycerol buffer에 보존되어 안정적 사용 가능.

카탈로그번호
HPA041482-xxx (2개 옵션)
카테고리
Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041482-100 Anti-ANKS3 Antibody, ankyrin repeat and sterile alpha motif domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041482-25 Anti-ANKS3 Antibody, ankyrin repeat and sterile alpha motif domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANKS3 Antibody

Anti-ANKS3 Antibody

Target: ankyrin repeat and sterile alpha motif domain containing 3
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ANKS3.


Alternative Gene Names

FLJ32345, FLJ32767, KIAA1977

Open Datasheet


Target Information

항목 내용
Target Protein ankyrin repeat and sterile alpha motif domain containing 3
Target Gene ANKS3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (63%), Rat (63%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Determine optimal concentrations and conditions for each application.

Antigen Sequence

REEHAFCANLGPVQSSSSSEGLARAQGLSSEASVESNEDSDHACKSSARKQAKSYMKTKNPDSQWPPRTATDREGFLAESSPQTQRAPYSGPQD


Safety Information

Material Safety Data Sheet


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.