
원본
Thermo Fisher Scientific SEMA4F Polyclonal Antibody
상품 한눈에 보기
SEMA4F 단백질을 인식하는 Rabbit Polyclonal 항체로 Western blot에 적합. Human 시료 반응성 확인. 합성 펩타이드 면역원으로 제작되었으며, 액상 형태로 제공. -20°C 보관 권장.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 29. 오후 05:30
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA542878 SEMA4F Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
630,500원VAT 포함 693,550원
Thermo Fisher Scientific · Thermo Fisher Scientific SEMA4F Polyclonal Antibody
Applications
- Western Blot (WB): 1:600 dilution
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the N-terminal of human SEMA4F |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2609885 |
Product Specific Information
- Peptide sequence: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
- Sequence homology:
- Cow: 100%
- Dog: 93%
- Guinea Pig: 100%
- Horse: 100%
- Human: 100%
- Mouse: 100%
- Rabbit: 100%
- Rat: 100%
Target Information
SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
