
원본
Atlas Antibodies Anti-MLC1 Antibody
상품 한눈에 보기
Human MLC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 실험에 적합함. Orthogonal 및 Recombinant Expression 검증 완료. 고순도 Affinity 정제 항체로 높은 특이성과 재현성을 제공.
- 카탈로그번호
- HPA067533-xxx (2개 옵션)
- 카테고리
- Antibodies
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA067533-100 Anti-MLC1 Antibody, megalencephalic leukoencephalopathy with subcortical cysts 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067533-25 Anti-MLC1 Antibody, megalencephalic leukoencephalopathy with subcortical cysts 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MLC1 Antibody
Anti-MLC1 Antibody
Target: megalencephalic leukoencephalopathy with subcortical cysts 1 (MLC1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
- WB (Recombinant Expression Validation): Validation using target protein overexpression.
Product Description
Polyclonal antibody against Human MLC1.
Alternative Gene Names
KIAA0027, LVM, MLC, VL
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Megalencephalic leukoencephalopathy with subcortical cysts 1 |
| Target Gene | MLC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MTQEPFREELAYDRMPTLERGRQDPASYAPDAKPSDLQLSKRLPPCFSHK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (75%, ENSMUSG00000035805), Rat (71%, ENSRNOG00000032871) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



