CacheBy
Atlas Antibodies Anti-MLANA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MLANA Antibody

상품 한눈에 보기

Human MLANA(melan-A) 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터와의 Orthogonal 검증을 통해 발현 신뢰성을 확보. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화정제됨. Human에 반응하며 MART1 대체 유전자명 포함.

카탈로그번호
HPA048662-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048662-100 Anti-MLANA Antibody, melan-A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048662-25 Anti-MLANA Antibody, melan-A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MLANA Antibody

Anti-MLANA Antibody

Target: melan-A
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB Orthogonal Validation: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human MLANA


Alternative Gene Names

  • MART1

Open Datasheet


Specifications

항목 내용
Target Protein melan-A
Target Gene MLANA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000036608 (67%), Mouse ENSMUSG00000024806 (64%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

RRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.