Atlas Antibodies Anti-MFF Antibody

상품 한눈에 보기

Human MFF 단백질을 인식하는 폴리클로날 항체로, 미토콘드리아 분열 인자 연구용에 적합. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. IHC 등 다양한 응용 가능. Human에 대해 검증된 반응성을 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA074625-100 Anti-MFF Antibody, mitochondrial fission factor 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA074625-25 Anti-MFF Antibody, mitochondrial fission factor 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Mitochondrial Fission Factor (MFF)
Supplier: Atlas Antibodies

Immunohistochemistry (IHC)

Polyclonal antibody against human MFF.

Target Protein: Mitochondrial fission factor
Target Gene: MFF
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

RFQAPISAPEYTVTPSPQQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKR

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000026150	94%
Rat	ENSRNOG00000048016	83%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand