CacheBy
Atlas Antibodies Anti-MFHAS1 Antibody
원본

Atlas Antibodies Anti-MFHAS1 Antibody

상품 한눈에 보기

Human MFHAS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Affinity purified 방식으로 고순도 확보. MFHAS1 관련 연구 및 단백질 검출에 활용 가능.

카탈로그번호
HPA054471-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054471-100 Anti-MFHAS1 Antibody, malignant fibrous histiocytoma amplified sequence 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054471-25 Anti-MFHAS1 Antibody, malignant fibrous histiocytoma amplified sequence 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MFHAS1 Antibody

Anti-MFHAS1 Antibody

malignant fibrous histiocytoma amplified sequence 1

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human MFHAS1.

Alternative Gene Names

  • LRRC65
  • MASL1

Open Datasheet

Target Information

항목 내용
Target Protein malignant fibrous histiocytoma amplified sequence 1
Target Gene MFHAS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000070056 (100%), Rat ENSRNOG00000011431 (90%)

Antigen Sequence (PrEST):
PGLHYTVHILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKKNVGEKHR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.