CacheBy
Atlas Antibodies Anti-MED6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MED6 Antibody

상품 한눈에 보기

Human MED6 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤/PBS 버퍼에 보존. 사람에 대해 검증되었으며 쥐, 생쥐와 높은 서열 유사성 보유.

카탈로그번호
HPA030764-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030764-100 Anti-MED6 Antibody, mediator complex subunit 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030764-25 Anti-MED6 Antibody, mediator complex subunit 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MED6 Antibody

Anti-MED6 Antibody

Target Information

  • Target Protein: Mediator complex subunit 6
  • Target Gene: MED6
  • Alternative Gene Names: NY-REN-28

Product Description

Polyclonal antibody against human MED6, produced in rabbit. Verified reactivity with human samples.

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    NSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVRPKAKRKEEPSSI

Species Reactivity

  • Verified Species: Human
  • Ortholog Identity:
    • Rat (ENSRNOG00000006976): 99%
    • Mouse (ENSMUSG00000002679): 99%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes Gently mix before use. Determine optimal concentrations and conditions experimentally.

Safety Information

Material Safety Data Sheet (MSDS)

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.