CacheBy
Atlas Antibodies Anti-MED8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2
Atlas Antibodies

Atlas Antibodies Anti-MED8 Antibody

상품 한눈에 보기

Human MED8 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human, Mouse, Rat 반응성이 검증되었습니다.

카탈로그번호
HPA028438-xxx (2개 옵션)
브랜드
Atlas Antibodies
카테고리
Polyclonal Antibodies
판매단위
100ul, 25ul
#Antibodies#Atlas Antibodies

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028438-100 Anti-MED8 Antibody, mediator complex subunit 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028438-25 Anti-MED8 Antibody, mediator complex subunit 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MED8 Antibody

Anti-MED8 Antibody

Target Information

  • Target Protein: Mediator complex subunit 8
  • Target Gene: MED8
  • Alternative Gene Names: ARC32, MGC17544, MGC19641
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human MED8, generated in rabbit. Suitable for detection of MED8 protein in human, mouse, and rat samples.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    VIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQ

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000006392 100%
Rat ENSRNOG00000019211 32%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Component Description
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기
Atlas AntibodiesAtlas Antibodies Anti-MED6 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-MED9 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-MED8 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-MED4 Antibody528,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.