AI 생성

1 / 2

Atlas Antibodies Anti-MCM2 Antibody

상품 한눈에 보기

인간 MCM2 단백질을 인식하는 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합하며, RNA-seq 데이터 기반 Orthogonal validation 수행. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031496-100 Anti-MCM2 Antibody, minichromosome maintenance complex component 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031496-25 Anti-MCM2 Antibody, minichromosome maintenance complex component 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Minichromosome maintenance complex component 2
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data in tissues with high and low target expression
Western Blot (WB)
Immunocytochemistry (ICC)

Polyclonal antibody against Human MCM2

BM28, CCNL1, cdc19, CDCL1, D3S3194, KIAA0030

항목	내용
Target Protein	Minichromosome maintenance complex component 2
Target Gene	MCM2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (98%), Rat (98%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

SKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAP

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

ICC

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.