
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MCM2 Antibody
상품 한눈에 보기
인간 MCM2 단백질을 인식하는 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합하며, RNA-seq 데이터 기반 Orthogonal validation 수행. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공.
- 카탈로그번호
- HPA031496-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031496-100 Anti-MCM2 Antibody, minichromosome maintenance complex component 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031496-25 Anti-MCM2 Antibody, minichromosome maintenance complex component 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MCM2 Antibody
Anti-MCM2 Antibody
Target: Minichromosome maintenance complex component 2
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data in tissues with high and low target expression
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human MCM2
Alternative Gene Names
BM28, CCNL1, cdc19, CDCL1, D3S3194, KIAA0030
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Minichromosome maintenance complex component 2 |
| Target Gene | MCM2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (98%), Rat (98%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
SKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAPNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



