CacheBy
Atlas Antibodies Anti-MCIDAS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MCIDAS Antibody

상품 한눈에 보기

인간 MCIDAS 단백질에 특이적인 폴리클로날 항체로, 다섯모세포 분화 및 DNA 합성 관련 연구에 적합. 토끼 유래 IgG 형식이며, PrEST 항원으로 친화 정제됨. 인체 반응성 검증 완료, 마우스 및 랫과 높은 서열 유사성 보유.

카탈로그번호
HPA058073-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058073-100 Anti-MCIDAS Antibody, multiciliate differentiation and DNA synthesis associated cell cycle protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058073-25 Anti-MCIDAS Antibody, multiciliate differentiation and DNA synthesis associated cell cycle protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MCIDAS Antibody

Anti-MCIDAS Antibody

Multiciliate differentiation and DNA synthesis associated cell cycle protein

ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human MCIDAS

Alternative Gene Names

  • IDAS
  • MCI
  • MCIN

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Multiciliate differentiation and DNA synthesis associated cell cycle protein
Target Gene MCIDAS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000074651 (81%), Rat ENSRNOG00000039588 (78%)

Antigen Sequence:
ANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFSTRIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.