
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MCIDAS Antibody
상품 한눈에 보기
인간 MCIDAS 단백질에 특이적인 폴리클로날 항체로, 다섯모세포 분화 및 DNA 합성 관련 연구에 적합. 토끼 유래 IgG 형식이며, PrEST 항원으로 친화 정제됨. 인체 반응성 검증 완료, 마우스 및 랫과 높은 서열 유사성 보유.
- 카탈로그번호
- HPA058073-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058073-100 Anti-MCIDAS Antibody, multiciliate differentiation and DNA synthesis associated cell cycle protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058073-25 Anti-MCIDAS Antibody, multiciliate differentiation and DNA synthesis associated cell cycle protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MCIDAS Antibody
Anti-MCIDAS Antibody
Multiciliate differentiation and DNA synthesis associated cell cycle protein
Recommended Applications
ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human MCIDAS
Alternative Gene Names
- IDAS
- MCI
- MCIN
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Multiciliate differentiation and DNA synthesis associated cell cycle protein |
| Target Gene | MCIDAS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000074651 (81%), Rat ENSRNOG00000039588 (78%) |
Antigen Sequence:
ANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFSTRIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWV
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



