
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MCAT Antibody
상품 한눈에 보기
인간 MCAT 단백질을 표적으로 하는 토끼 폴리클로날 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, 높은 종간 서열 일치도를 가짐. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.
- 카탈로그번호
- HPA003122-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA003122-100 Anti-MCAT Antibody, malonyl CoA:ACP acyltransferase (mitochondrial) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003122-25 Anti-MCAT Antibody, malonyl CoA:ACP acyltransferase (mitochondrial) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MCAT Antibody
Anti-MCAT Antibody
Target Information
- Protein: malonyl CoA:ACP acyltransferase (mitochondrial)
- Gene: MCAT
- Alternative Gene Names: fabD, FASN2C, MCT, MT, NET62
Product Description
Polyclonal antibody against human MCAT.
Recommended Applications
이미지 내 텍스트(OCR): ICC (Immunocytochemistry)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
MPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAE
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000010539 | 87% |
| Mouse | ENSMUSG00000048755 | 84% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



