
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MC5R Antibody
상품 한눈에 보기
Human MC5R을 타깃으로 하는 Rabbit Polyclonal Antibody로, melanocortin 5 receptor 검출에 적합합니다. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. PBS와 glycerol 기반 버퍼로 안정화되어 있습니다.
- 카탈로그번호
- HPA058088-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058088-100 Anti-MC5R Antibody, melanocortin 5 receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058088-25 Anti-MC5R Antibody, melanocortin 5 receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MC5R Antibody
Anti-MC5R Antibody
Target Information
- Target Protein: melanocortin 5 receptor
- Target Gene: MC5R
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDM
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal Antibody against Human MC5R.
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000016685 | 69% |
| Mouse | ENSMUSG00000007480 | 58% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



