CacheBy
Atlas Antibodies Anti-MAVS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAVS Antibody

상품 한눈에 보기

Human MAVS 단백질을 인식하는 rabbit polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Cardif, IPS-1 등 다양한 대체 유전자명으로 알려진 단백질을 타깃합니다. Human 반응성이 검증되었습니다.

카탈로그번호
HPA049850-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049850-100 Anti-MAVS Antibody, mitochondrial antiviral signaling protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049850-25 Anti-MAVS Antibody, mitochondrial antiviral signaling protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAVS Antibody

Anti-MAVS Antibody

Target: mitochondrial antiviral signaling protein (MAVS)
Type: Polyclonal Antibody against Human MAVS

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Product Description

  • Polyclonal antibody against human MAVS
  • Validated for immunohistochemistry (IHC)
  • Designed for detection of mitochondrial antiviral signaling protein

Alternative Gene Names

Cardif, IPS-1, KIAA1271, VISA

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein mitochondrial antiviral signaling protein
Target Gene MAVS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000025295 (46%), Mouse ENSMUSG00000037523 (41%)

Antigen Sequence:
PVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
Tooltip Independent

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.