
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MAVS Antibody
상품 한눈에 보기
Human MAVS 단백질을 인식하는 rabbit polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Cardif, IPS-1 등 다양한 대체 유전자명으로 알려진 단백질을 타깃합니다. Human 반응성이 검증되었습니다.
- 카탈로그번호
- HPA049850-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049850-100 Anti-MAVS Antibody, mitochondrial antiviral signaling protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049850-25 Anti-MAVS Antibody, mitochondrial antiviral signaling protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAVS Antibody
Anti-MAVS Antibody
Target: mitochondrial antiviral signaling protein (MAVS)
Type: Polyclonal Antibody against Human MAVS
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
- Polyclonal antibody against human MAVS
- Validated for immunohistochemistry (IHC)
- Designed for detection of mitochondrial antiviral signaling protein
Alternative Gene Names
Cardif, IPS-1, KIAA1271, VISA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial antiviral signaling protein |
| Target Gene | MAVS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000025295 (46%), Mouse ENSMUSG00000037523 (41%) |
Antigen Sequence:
PVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKV
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



