CacheBy
Atlas Antibodies Anti-MARS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MARS2 Antibody

상품 한눈에 보기

Human MARS2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 가짐. PBS와 글리세롤 버퍼에 보존제로 sodium azide 포함.

카탈로그번호
HPA035590-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035590-100 Anti-MARS2 Antibody, methionyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035590-25 Anti-MARS2 Antibody, methionyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MARS2 Antibody

Anti-MARS2 Antibody

Target: methionyl-tRNA synthetase 2, mitochondrial (MARS2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MARS2.


Alternative Gene Names

mtMetRS, SPAX3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein methionyl-tRNA synthetase 2, mitochondrial
Target Gene MARS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence WLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLGVSASERSLGELYFLPRFYGHPCPFEGRRLGPETGLLFPRLDQSRTWLVKAHRT

Species Reactivity

Verified: Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000050002): 93%
  • Mouse (ENSMUSG00000046994): 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.