CacheBy
Atlas Antibodies Anti-MARS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MARS Antibody

상품 한눈에 보기

Human MARS 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 유전자 기반 검증 완료. Methionyl-tRNA synthetase 검출에 적합하며, 높은 특이성과 재현성을 제공. Affinity purified 방식으로 제조됨.

카탈로그번호
HPA004125-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004125-100 Anti-MARS Antibody, methionyl-tRNA synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004125-25 Anti-MARS Antibody, methionyl-tRNA synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MARS Antibody

Anti-MARS Antibody

Target: methionyl-tRNA synthetase (MARS)

  • IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Genetic validation in WB by siRNA knockdown.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human MARS (methionyl-tRNA synthetase).

Alternative Gene Names

MetRS, SPG70

Target Information

항목 내용
Target Protein methionyl-tRNA synthetase
Target Gene MARS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence FVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFD
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000025459 (92%), Mouse ENSMUSG00000040354 (92%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Genetic Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.