
Atlas Antibodies Anti-MAPRE1 Antibody
Human MAPRE1 단백질을 인식하는 고품질 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. Orthogonal 검증을 통해 RNA-seq 데이터와 단백질 발현 비교가 가능하며, Rabbit IgG 형식으로 높은 특이성과 재현성을 제공합니다.
- 카탈로그번호
- HPA003600-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-MAPRE1 Antibody
Anti-MAPRE1 Antibody
microtubule-associated protein, RP/EB family, member 1
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human MAPRE1
Alternative Gene Names
EB1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | microtubule-associated protein, RP/EB family, member 1 |
| Target Gene | MAPRE1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Mouse ENSMUSG00000027479 (94%), Rat ENSRNOG00000011798 (93%) |
Antigen Sequence:
VAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDE
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



