Atlas Antibodies Anti-MAPKAPK2 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA045556-100 | - | Atlas Antibodies HPA045556-100 Anti-MAPKAPK2 Antibody, mitogen-activated protein kinase-activated protein kinase 2 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA045556-25 | - | Atlas Antibodies HPA045556-25 Anti-MAPKAPK2 Antibody, mitogen-activated protein kinase-activated protein kinase 2 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-MAPKAPK2 Antibody
mitogen-activated protein kinase-activated protein kinase 2
Recommended Applications
Product Description
Polyclonal Antibody against Human MAPKAPK2
Target Protein
mitogen-activated protein kinase-activated protein kinase 2
Target Gene
MAPKAPK2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000016528 (95%)
Rat ENSRNOG00000004726 (92%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|