CacheBy
Atlas Antibodies Anti-MAPK6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAPK6 Antibody

상품 한눈에 보기

Human MAPK6를 인식하는 Rabbit Polyclonal Antibody로 IHC, WB, ICC 등 다양한 응용에 적합. ERK3, p97MAPK 등 대체 유전자명 포함. PrEST 항원을 이용해 Affinity 정제되어 높은 특이성과 재현성을 제공.

카탈로그번호
HPA030262-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030262-100 Anti-MAPK6 Antibody, mitogen-activated protein kinase 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030262-25 Anti-MAPK6 Antibody, mitogen-activated protein kinase 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAPK6 Antibody

Anti-MAPK6 Antibody

Target Information

  • Target Protein: Mitogen-activated protein kinase 6
  • Target Gene: MAPK6
  • Alternative Gene Names: ERK3, HsT17250, p97MAPK, PRKM6
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human MAPK6

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

YSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDCQFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000009381 96%
Mouse ENSMUSG00000042688 96%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.