CacheBy
Atlas Antibodies Anti-MAP4K3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAP4K3 Antibody

상품 한눈에 보기

Human MAP4K3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 등 다양한 면역학적 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 대해 검증된 반응성을 가집니다.

카탈로그번호
HPA030380-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030380-100 Anti-MAP4K3 Antibody, mitogen-activated protein kinase kinase kinase kinase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030380-25 Anti-MAP4K3 Antibody, mitogen-activated protein kinase kinase kinase kinase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAP4K3 Antibody

Anti-MAP4K3 Antibody

Target: mitogen-activated protein kinase kinase kinase kinase 3 (MAP4K3)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human MAP4K3.

Alternative Gene Names

GLK, MAPKKKK3, RAB8IPL1

Open Datasheet

Target Information

  • Target Protein: mitogen-activated protein kinase kinase kinase kinase 3
  • Target Gene: MAP4K3

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVALGNGMSSFQLNGERDGSLCQQQNEHRGTNLSRKEKKDVP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000007172 (85%)
  • Mouse ENSMUSG00000024242 (85%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.