Atlas Antibodies Anti-MAP2K6 Antibody

상품 한눈에 보기

Human MAP2K6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal validation을 통해 단백질 발현 검증. 높은 종간 반응성(인간, 마우스, 랫트) 확인. Affinity purification 방식으로 높은 특이성과 재현성 보장.

카탈로그번호: HPA031134-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031134-100 Anti-MAP2K6 Antibody, mitogen-activated protein kinase kinase 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031134-25 Anti-MAP2K6 Antibody, mitogen-activated protein kinase kinase 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MAP2K6 Antibody

Anti-MAP2K6 Antibody

mitogen-activated protein kinase kinase 6

Recommended Applications

IHC (Orthogonal validation)
WB (Western Blot)
ICC (Immunocytochemistry)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human MAP2K6

Alternative Gene Names

MAPKK6, MEK6, MKK6, PRKMK6, SAPKK3

Open Datasheet

Target Information

항목	내용
Target Protein	mitogen-activated protein kinase kinase 6
Target Gene	MAP2K6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGR

Species Reactivity

Human
Mouse
Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000020623 (98%)
Rat ENSRNOG00000004437 (97%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand