CacheBy
Atlas Antibodies Anti-MAGI3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAGI3 Antibody

상품 한눈에 보기

인간 MAGI3 단백질에 특이적인 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. PBS와 글리세롤 버퍼에 보존제로 sodium azide가 포함되어 있습니다.

카탈로그번호
HPA008444-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008444-100 Anti-MAGI3 Antibody, membrane associated guanylate kinase, WW and PDZ domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008444-25 Anti-MAGI3 Antibody, membrane associated guanylate kinase, WW and PDZ domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAGI3 Antibody

Anti-MAGI3 Antibody

Target: membrane associated guanylate kinase, WW and PDZ domain containing 3
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human MAGI3 protein.

Alternative Gene Names

  • MAGI-3
  • Immunohistochemistry (IHC)

Target Information

  • Target Protein: membrane associated guanylate kinase, WW and PDZ domain containing 3
  • Target Gene: MAGI3

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LKVGDHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRPMGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCYPVELERGPRGFGFSLRG

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000052539 94%
Rat ENSRNOG00000019885 93%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.