Atlas Antibodies Anti-MAGI1 Antibody

상품 한눈에 보기

Human MAGI1 단백질을 표적으로 하는 토끼 유래 폴리클로날 항체. Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합. 고순도 및 높은 종 간 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031853-100 Anti-MAGI1 Antibody, membrane associated guanylate kinase, WW and PDZ domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031853-25 Anti-MAGI1 Antibody, membrane associated guanylate kinase, WW and PDZ domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

membrane associated guanylate kinase, WW and PDZ domain containing 1

면역세포화학 (ICC)

Polyclonal Antibody against Human MAGI1

AIP3, BAIAP1, BAP1, MAGI-1, TNRC19, WWP3

항목	내용
Target Protein	membrane associated guanylate kinase, WW and PDZ domain containing 1
Target Gene	MAGI1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	IVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQTD
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000045095 (93%), Rat ENSRNOG00000022060 (92%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand