CacheBy
Atlas Antibodies Anti-MAFB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAFB Antibody

상품 한눈에 보기

인간 MAFB 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 종간 보존성(마우스·랫 98%)을 보임. PBS/glycerol buffer에 sodium azide 보존제 포함.

카탈로그번호
HPA005653-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA005653-100 Anti-MAFB Antibody, v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005653-25 Anti-MAFB Antibody, v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAFB Antibody

Anti-MAFB Antibody

Target: v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B (MAFB)
Type: Polyclonal Antibody against Human MAFB
Host: Rabbit
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against the human MAFB protein. It is affinity purified using the PrEST antigen as an affinity ligand and is suitable for use in IHC and ICC applications.


Alternative Gene Names

  • KRML

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B
Target Gene MAFB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (ENSMUSG00000074622, 98%), Rat (ENSRNOG00000016037, 98%)

Antigen Sequence:

MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage/Handling Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.
MSDS Material Safety Data Sheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.