Atlas Antibodies Anti-MAFB Antibody

상품 한눈에 보기

인간 MAFB 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 종간 보존성(마우스·랫 98%)을 보임. PBS/glycerol buffer에 sodium azide 보존제 포함.

카탈로그번호: HPA005653-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA005653-100 Anti-MAFB Antibody, v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA005653-25 Anti-MAFB Antibody, v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MAFB Antibody

Anti-MAFB Antibody

Target: v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B (MAFB)
Type: Polyclonal Antibody against Human MAFB
Host: Rabbit
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against the human MAFB protein. It is affinity purified using the PrEST antigen as an affinity ligand and is suitable for use in IHC and ICC applications.

Alternative Gene Names

KRML

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B
Target Gene	MAFB
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (ENSMUSG00000074622, 98%), Rat (ENSRNOG00000016037, 98%)

Antigen Sequence:

MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage/Handling Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
MSDS	Material Safety Data Sheet