Atlas Antibodies Anti-MADCAM1 Antibody

상품 한눈에 보기

인체 MADCAM1 단백질을 표적으로 하는 Rabbit Polyclonal 항체입니다. 면역조직화학(IHC) 등 다양한 연구 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human 반응성 검증 완료, 안정적 PBS/glycerol buffer 포맷.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA077998-100 Anti-MADCAM1 Antibody, mucosal vascular addressin cell adhesion molecule 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA077998-25 Anti-MADCAM1 Antibody, mucosal vascular addressin cell adhesion molecule 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Mucosal vascular addressin cell adhesion molecule 1 (MADCAM1)

면역조직화학 (IHC) 등 다양한 연구 응용에 적합

Polyclonal antibody against human MADCAM1

MACAM1

Target Protein: Mucosal vascular addressin cell adhesion molecule 1
Target Gene: MADCAM1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
YHLWKRCRHLAEDDTHPPASLRLLPQVSAWAGLRGTGQVGIS
```

Human

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000030017	33%
Mouse	ENSMUSG00000006542	31%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method	Affinity purified using the PrEST antigen as affinity ligand